Loading... Please wait...
  • Image 1

Anti-EP4 Receptor (C-term): SureLight® R-PE, 50ug


Product Description

Anti-EP4 (Prostaglandin E4) Receptor (C-term.) conjugated to SureLight® R-PE, 50ug


Item # D5-1866


  Antibody Rabbit anti-EP4 REceptor (C-term.) IgG
  Specificity EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
  Reactivity Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested.


SureLight® R-Phycoerythrin

Excitation max. λ

565>498 nm

Emission max. λ

578 nm


Flow cytometry and cell-based assays


Upon receipt, store at 2-8°C.


Product should be stored at 2-8°C in the dark and be used within 3 months.  If further dilution of the conjugate is required, use diluted material within one week.

Technical Info

Technical Data Sheet   Safety Data Sheet (SDS)         References



Product Reviews

Write Review

This product hasn't received any reviews yet. Be the first to review this product!

