Anti-EP4 (Prostaglandin E4) Receptor (C-term.) conjugated to SureLight® APC, 50 ug |
Item # D3-1866 | ||
Size |
50μg | |
Antibody | Rabbit anti-EP4 Receptor (C-term.) IgG | |
Specificity | EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) | |
Reactivity | Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested. | |
Dye |
SureLight® Allophycocyanin (APC) | |
Excitation max. λ |
650 nm | |
Emission max. λ |
660 nm | |
Uses |
Flow cytometry and cell-based assays | |
Form/Storage |
Upon receipt, store kit at 2-8°C. | |
Stability |
Product should be stored at 2-8°C in the dark and be used within 3 months. If further dilution of the conjugate is required, use diluted material within one week. | |
Technical Info |
Technical Data Sheet Safety Data Sheet (SDS) References |