Loading... Please wait...
  • Image 1

Anti-EP4 Receptor (C-term):SureLight® APC, 50ug

$329.00

Product Description

Anti-EP4 (Prostaglandin E4) Receptor (C-term.) conjugated to SureLight® APC, 50 ug

 

Item # D3-1866

Size

50μg
  Antibody Rabbit anti-EP4 Receptor (C-term.) IgG
  Specificity EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
  Reactivity Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested.

Dye

SureLight® Allophycocyanin (APC)

Excitation max. λ

650 nm

Emission max. λ

660 nm

Uses

Flow cytometry and cell-based assays

Form/Storage

Upon receipt, store kit at 2-8°C.

Stability

Product should be stored at 2-8°C in the dark and be used within 3 months.  If further dilution of the conjugate is required, use diluted material within one week.

Technical Info

Technical Data Sheet  Safety Data Sheet (SDS)          References

 

 
 
 

Product Reviews

Write Review

This product hasn't received any reviews yet. Be the first to review this product!

Quantity:

SKU:
D3-1866